Host taxon 9606
Protein NP_001001342.1
biogenesis of lysosome-related organelles complex 1 subunit 2 isoform 2
Homo sapiens
Gene BLOC1S2, UniProt Q6QNY1
>NP_001001342.1|Haemophilus ducreyi 35000HP|biogenesis of lysosome-related organelles complex 1 subunit 2 isoform 2
MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.71 | 0.710907456424312 | 0.0026 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)