Host taxon 9606
Protein NP_001001786.2
BH3-like motif-containing cell death inducer
Homo sapiens
Gene BLID, UniProt Q8IZY5
>NP_001001786.2|Haemophilus ducreyi 35000HP|BH3-like motif-containing cell death inducer
MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.35 | -1.34552853123713 | 0.0023 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)