Host taxon 9606
Protein NP_001012329.1
beta-catenin-interacting protein 1
Homo sapiens
Gene CTNNBIP1, UniProt Q9NSA3
>NP_001012329.1|Haemophilus ducreyi 35000HP|beta-catenin-interacting protein 1
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.39 | -1.39234871642911 | 0.00022 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)