Host taxon 9606
Protein NP_001092257.1
BET1-like protein isoform 1
Homo sapiens
Gene BET1L, UniProt Q9NYM9
>NP_001092257.1|Haemophilus ducreyi 35000HP|BET1-like protein isoform 1
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.39 | 0.385428533637674 | 0.04 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)