Host taxon 9606
Protein NP_001191035.1
bcl-2-like protein 11 isoform 11
Homo sapiens
Gene BCL2L11, UniProt O43521
>NP_001191035.1|Haemophilus ducreyi 35000HP|bcl-2-like protein 11 isoform 11
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.8 | 1.80139494800787 | 2.1e-8 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)