Host taxon 9606
Protein NP_001287736.1
basic leucine zipper transcriptional factor ATF-like 2 isoform 2
Homo sapiens
Gene BATF2, UniProt Q8N1L9
>NP_001287736.1|Haemophilus ducreyi 35000HP|basic leucine zipper transcriptional factor ATF-like 2 isoform 2
MAPVGKRIGGLGDTRVGGPCISQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6.72 | 6.71995544004611 | 1.3e-25 | 31213562 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)