Host taxon 9606
Protein NP_001012270.1
baculoviral IAP repeat-containing protein 5 isoform 2
Homo sapiens
Gene BIRC5, UniProt O15392
>NP_001012270.1|Haemophilus ducreyi 35000HP|baculoviral IAP repeat-containing protein 5 isoform 2
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPMQRKPTIRRKNLRKLRRKCAVPSSSWLPWIEASGRSCLVPEWLHHFQGLFPGATSLPVGPLAMS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.26 | 2.26341833777148 | 1.1e-8 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)