Host taxon 9606
Protein NP_001308145.1
B9 domain-containing protein 1 isoform f
Homo sapiens
Gene B9D1, UniProt Q9UPM9
>NP_001308145.1|Haemophilus ducreyi 35000HP|B9 domain-containing protein 1 isoform f
MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSLCLVASSDLQAAPPTEDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.45 | -1.44647156301743 | 1.3e-5 | 31213562 | |
Retrieved 1 of 4 entries in 1.3 ms
(Link to these results)