Host taxon 9606
Protein NP_001184173.1
B-cell CLL/lymphoma 7 protein family member B isoform 2
Homo sapiens
Gene BCL7B, UniProt Q9BQE9
>NP_001184173.1|Haemophilus ducreyi 35000HP|B-cell CLL/lymphoma 7 protein family member B isoform 2
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.79 | 0.79242564384972 | 5.8e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)