Host taxon 9606
Protein NP_001019979.1
B-cell CLL/lymphoma 7 protein family member A isoform b
Homo sapiens
Gene BCL7A, UniProt Q4VC05
>NP_001019979.1|Haemophilus ducreyi 35000HP|B-cell CLL/lymphoma 7 protein family member A isoform b
MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.69 | -1.68622326777113 | 0.0068 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)