Host taxon 9606
Protein NP_006003.1
ATP-dependent Clp protease proteolytic subunit, mitochondrial precursor
Homo sapiens
Gene CLPP, UniProt Q16740
>NP_006003.1|Haemophilus ducreyi 35000HP|ATP-dependent Clp protease proteolytic subunit, mitochondrial precursor
MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.82 | 0.820582279727626 | 0.0024 | 31213562 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)