Host taxon 9606
Protein NP_001003803.2
ATP synthase subunit s, mitochondrial isoform a precursor
Homo sapiens
Gene DMAC2L, UniProt Q99766
>NP_001003803.2|Haemophilus ducreyi 35000HP|ATP synthase subunit s, mitochondrial isoform a precursor
MMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.49 | -0.485321791672392 | 0.018 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)