Host taxon 9606
Protein NP_001688.1
ATP synthase subunit O, mitochondrial precursor
Homo sapiens
Gene ATP5PO, UniProt P48047
>NP_001688.1|Haemophilus ducreyi 35000HP|ATP synthase subunit O, mitochondrial precursor
MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.92 | 0.917135324546999 | 0.00091 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)