Host taxon 9606
Protein NP_008817.1
ATP synthase subunit epsilon, mitochondrial
Homo sapiens
Gene ATP5F1E, UniProt P56381
>NP_008817.1|Haemophilus ducreyi 35000HP|ATP synthase subunit epsilon, mitochondrial
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.48 | 1.48455344653653 | 5.5e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)