Host taxon 9606
Protein NP_009031.1
ATP synthase subunit e, mitochondrial
Homo sapiens
Gene ATP5ME, UniProt P56385
>NP_009031.1|Haemophilus ducreyi 35000HP|ATP synthase subunit e, mitochondrial
MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.25 | 1.24786200972581 | 0.0024 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)