Host taxon 9606
Protein NP_001193355.1
ATP synthase membrane subunit DAPIT, mitochondrial
Homo sapiens
Gene ATP5MD, UniProt Q96IX5
>NP_001193355.1|Haemophilus ducreyi 35000HP|ATP synthase membrane subunit DAPIT, mitochondrial
MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.1 | 1.09925361665767 | 0.00074 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)