Host taxon 9606
Protein NP_001002031.1
ATP synthase F(0) complex subunit C2, mitochondrial isoform a precursor
Homo sapiens
Gene ATP5MC2, UniProt Q06055
>NP_001002031.1|Haemophilus ducreyi 35000HP|ATP synthase F(0) complex subunit C2, mitochondrial isoform a precursor
MPELILSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.6 | 0.604449943741979 | 0.0066 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)