Host taxon 9606
Protein NP_001679.2
ATP synthase F(0) complex subunit B1, mitochondrial precursor
Homo sapiens
Gene ATP5PB, UniProt P24539
>NP_001679.2|Haemophilus ducreyi 35000HP|ATP synthase F(0) complex subunit B1, mitochondrial precursor
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.64 | 0.63760715993244 | 0.0054 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)