Host taxon 9606
Protein NP_001273466.1
ashwin isoform 2
Homo sapiens
Gene C2orf49, UniProt Q9BVC5
>NP_001273466.1|Haemophilus ducreyi 35000HP|ashwin isoform 2
MAGDVGGRSCTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPLIVFDGSSTSTSIKVKKTENGDNDRLKPPPQNHDLTHRKSPSGPVKSPPLSPVGTTPVKLKRAAPKEEAEAMNNLKPPQAKRKIQHVTWP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.46 | -0.462982339987071 | 0.0096 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)