Host taxon 9606
Protein NP_001284479.1
apelin receptor early endogenous ligand precursor
Homo sapiens
Gene APELA, UniProt P0DMC3
>NP_001284479.1|Haemophilus ducreyi 35000HP|apelin receptor early endogenous ligand precursor
MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.53 | 1.52937922056665 | 0.00013 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)