Host taxon 9606
Protein NP_059109.3
apelin preproprotein
Homo sapiens
Gene APLN, UniProt Q9ULZ1
>NP_059109.3|Haemophilus ducreyi 35000HP|apelin preproprotein
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.57 | 2.56518576825556 | 2.0e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)