Host taxon 9606
Protein NP_001288005.1
AP-2 complex subunit sigma isoform 3
Homo sapiens
Gene AP2S1, UniProt P53680
>NP_001288005.1|Haemophilus ducreyi 35000HP|AP-2 complex subunit sigma isoform 3
MKLKGLGKRCKRREDLEIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.48 | 1.47858551690421 | 2.5e-5 | 31213562 | |
Retrieved 1 of 4 entries in 1 ms
(Link to these results)