Host taxon 9606
Protein NP_003907.3
AP-1 complex subunit sigma-2 isoform 2
Homo sapiens
Gene AP1S2, UniProt P56377
>NP_003907.3|Haemophilus ducreyi 35000HP|AP-1 complex subunit sigma-2 isoform 2
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.91 | 0.90848081048156 | 0.00025 | 31213562 | |
Retrieved 1 of 3 entries in 1.4 ms
(Link to these results)