Host taxon 9606
Protein NP_001306074.1
antigen-presenting glycoprotein CD1d isoform 2 precursor
Homo sapiens
Gene CD1D, UniProt P15813
>NP_001306074.1|Haemophilus ducreyi 35000HP|antigen-presenting glycoprotein CD1d isoform 2 precursor
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.5 | 3.50396745155883 | 9.2e-14 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)