Host taxon 9606
Protein NP_001257306.1
ankyrin repeat domain-containing protein 46 isoform 1
Homo sapiens
Gene ANKRD46, UniProt Q86W74
>NP_001257306.1|Haemophilus ducreyi 35000HP|ankyrin repeat domain-containing protein 46 isoform 1
MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYVSGVLPFVENQPELVH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.55 | -0.550607102962879 | 0.0031 | 31213562 | |
Retrieved 1 of 3 entries in 1.6 ms
(Link to these results)