Host taxon 9606
Protein NP_644815.1
anaphase-promoting complex subunit CDC26
Homo sapiens
Gene CDC26, UniProt Q8NHZ8
>NP_644815.1|Haemophilus ducreyi 35000HP|anaphase-promoting complex subunit CDC26
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.68 | 0.68243549113468 | 0.048 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)