Host taxon 9606
Protein NP_001229303.1
anaphase-promoting complex subunit 13
Homo sapiens
Gene ANAPC13, UniProt Q9BS18
>NP_001229303.1|Haemophilus ducreyi 35000HP|anaphase-promoting complex subunit 13
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.76 | 0.76266140779956 | 9.8e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)