Host taxon 9606
Protein NP_872297.2
AN1-type zinc finger protein 2A isoform 1
Homo sapiens
Gene ZFAND2A, UniProt Q8N6M9
>NP_872297.2|Haemophilus ducreyi 35000HP|AN1-type zinc finger protein 2A isoform 1
MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.88 | 0.88087971120431 | 2.3e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)