Host taxon 9606
Protein NP_000336.1
alpha-synuclein isoform NACP140
Homo sapiens
Gene SNCA, UniProt P37840
>NP_000336.1|Haemophilus ducreyi 35000HP|alpha-synuclein isoform NACP140
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.09 | -1.09122077991761 | 0.0016 | 31213562 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)