Host taxon 9606
Protein NP_940975.2
adropin precursor
Homo sapiens
Gene ENHO, UniProt Q6UWT2
>NP_940975.2|Haemophilus ducreyi 35000HP|adropin precursor
MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.87 | -1.8746576592469 | 0.00047 | 31213562 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)