Host taxon 9606
Protein NP_775935.1
ADP-ribosylation factor-like protein 10 isoform 2
Homo sapiens
Gene ARL10, UniProt Q8N8L6
>NP_775935.1|Haemophilus ducreyi 35000HP|ADP-ribosylation factor-like protein 10 isoform 2
MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEPALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQREVFLLAASIAPAGPTFEEPGTVHIWKLLLELLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.71 | -0.712957093134721 | 0.0055 | 31213562 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)