Host taxon 9606
Protein NP_001650.1
ADP-ribosylation factor 3
Homo sapiens
Gene ARF3, UniProt P61204
>NP_001650.1|Haemophilus ducreyi 35000HP|ADP-ribosylation factor 3
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.48 | 0.476844858943512 | 0.0097 | 31213562 | |
Retrieved 1 of 2 entries in 2.3 ms
(Link to these results)