Host taxon 9606
Protein NP_004325.2
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 precursor
Homo sapiens
Gene BST1, UniProt Q10588
>NP_004325.2|Haemophilus ducreyi 35000HP|ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 precursor
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.32 | 1.32132300765288 | 0.0008 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)