Host taxon 9606
Protein NP_006820.1
adipogenesis regulatory factor
Homo sapiens
Gene ADIRF, UniProt Q15847
>NP_006820.1|Haemophilus ducreyi 35000HP|adipogenesis regulatory factor
MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.75 | -0.751909286228971 | 4.8e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)