Host taxon 9606
Protein NP_000476.1
adenine phosphoribosyltransferase isoform a
Homo sapiens
Gene APRT, UniProt P07741
>NP_000476.1|Haemophilus ducreyi 35000HP|adenine phosphoribosyltransferase isoform a
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.69 | 0.686466078841386 | 0.023 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)