Host taxon 9606
Protein NP_001257368.1
actin-related protein 2/3 complex subunit 5 isoform 2
Homo sapiens
Gene ARPC5, UniProt O15511
>NP_001257368.1|Haemophilus ducreyi 35000HP|actin-related protein 2/3 complex subunit 5 isoform 2
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.49 | 1.48541423715284 | 5.4e-10 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)