Host taxon 9606
Protein NP_001020130.1
actin-related protein 2/3 complex subunit 4 isoform b
Homo sapiens
Gene ARPC4, UniProt P59998
>NP_001020130.1|Haemophilus ducreyi 35000HP|actin-related protein 2/3 complex subunit 4 isoform b
MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.32 | 1.32499930930075 | 2.1e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)