Host taxon 9606
Protein NP_005161.1
achaete-scute homolog 2
Homo sapiens
Gene ASCL2, UniProt Q99929
>NP_005161.1|Haemophilus ducreyi 35000HP|achaete-scute homolog 2
MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.16 | 1.15960404624027 | 0.034 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)