Host taxon 9606
Protein NP_001311440.1
A disintegrin and metalloproteinase with thrombospondin motifs 12 isoform 2 precursor
Homo sapiens
Gene ADAMTS12, UniProt P58397
>NP_001311440.1|Haemophilus ducreyi 35000HP|A disintegrin and metalloproteinase with thrombospondin motifs 12 isoform 2 precursor
MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFWLFY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.48 | 1.48290184536697 | 2.2e-7 | 31213562 | |
Retrieved 1 of 2 entries in 0.3 ms
(Link to these results)