Host taxon 9606
Protein NP_002443.3
7,8-dihydro-8-oxoguanine triphosphatase isoform p18
Homo sapiens
Gene NUDT1, UniProt P36639
>NP_002443.3|Haemophilus ducreyi 35000HP|7,8-dihydro-8-oxoguanine triphosphatase isoform p18
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.01 | 1.01454824590815 | 3.8e-5 | 31213562 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)