Host taxon 9606
Protein NP_001186363.1
60S ribosome subunit biogenesis protein NIP7 homolog isoform 2
Homo sapiens
Gene NIP7, UniProt Q9Y221
>NP_001186363.1|Haemophilus ducreyi 35000HP|60S ribosome subunit biogenesis protein NIP7 homolog isoform 2
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.7 | 0.699061456753085 | 0.00021 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)