Host taxon 9606
Protein NP_443201.1
60S ribosomal protein L39-like
Homo sapiens
Gene RPL39L, UniProt Q96EH5
>NP_443201.1|Haemophilus ducreyi 35000HP|60S ribosomal protein L39-like
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.97 | 0.969487062691078 | 0.014 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)