Host taxon 9606
Protein NP_000992.1
60S ribosomal protein L36a-like
Homo sapiens
Gene RPL36AL, UniProt Q969Q0
>NP_000992.1|Haemophilus ducreyi 35000HP|60S ribosomal protein L36a-like
MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.61 | 1.61063161848911 | 1.0e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)