Host taxon 9606
Protein NP_001304909.1
60S ribosomal protein L26-like 1
Homo sapiens
Gene RPL26L1, UniProt Q9UNX3
>NP_001304909.1|Haemophilus ducreyi 35000HP|60S ribosomal protein L26-like 1
MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.15 | 1.15243540952002 | 2.0e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)