Host taxon 9606
Protein NP_001093115.1
60S ribosomal protein L22-like 1 isoform 1
Homo sapiens
Gene RPL22L1, UniProt Q6P5R6
>NP_001093115.1|Haemophilus ducreyi 35000HP|60S ribosomal protein L22-like 1 isoform 1
MAPQKDRKPKRSTWRFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKNKITVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESESED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.44 | 1.43542677682726 | 3.7e-7 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)