Host taxon 9606
Protein NP_000967.1
60S ribosomal protein L12
Homo sapiens
Gene RPL12, UniProt P30050
>NP_000967.1|Haemophilus ducreyi 35000HP|60S ribosomal protein L12
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1 | 1.00118551564031 | 0.0079 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)