Bacterial taxon 233412
Protein WP_010945717.1
50S ribosomal protein L22
Haemophilus ducreyi 35000HP
Gene rplV, UniProt Q7VKD6
>WP_010945717.1|Haemophilus ducreyi 35000HP|50S ribosomal protein L22
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKASALVKKVLESAIANAEHNDGADVDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ 0,69 | 0.685361332809471 | 0,0053 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 1,6 ms
(Link to these results)