Host taxon 9606
Protein NP_001239306.1
5'(3')-deoxyribonucleotidase, cytosolic type isoform 2
Homo sapiens
Gene NT5C, UniProt Q8TCD5
>NP_001239306.1|Haemophilus ducreyi 35000HP|5'(3')-deoxyribonucleotidase, cytosolic type isoform 2
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.01 | 1.01332720431297 | 4.4e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)