Host taxon 9606
Protein NP_001128142.1
4-hydroxy-2-oxoglutarate aldolase, mitochondrial isoform 2
Homo sapiens
Gene HOGA1, UniProt Q86XE5
>NP_001128142.1|Haemophilus ducreyi 35000HP|4-hydroxy-2-oxoglutarate aldolase, mitochondrial isoform 2
MLGPQVWSSVRQGLSRSLSRNVGVWASGEGKKVDIAGIYPPVTTPFTATAEVDYGKLEENLHKLGTFPFRGAVGGVCALANVLGAQVCQLERLCCTGQWEDAQKLQHRLIEPNAAVTRRFGIPGLKKIMDWFGYYGGPCRAPLQELSPAEEEALRMDFTSNGWL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.56 | -1.55783883614299 | 5.2e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)