Host taxon 9606
Protein NP_848026.1
39S ribosomal protein L52, mitochondrial isoform a
Homo sapiens
Gene MRPL52, UniProt Q86TS9
>NP_848026.1|Haemophilus ducreyi 35000HP|39S ribosomal protein L52, mitochondrial isoform a
MAALGTVLFTGVRRLHCSVAAWAGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.27 | 1.26824280331925 | 0.00069 | 31213562 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)